(data stored in ACNUC8465 zone)

EMBL: FN543502.SFSA

FN543502.SFSA        Location/Qualifiers
FT   CDS             complement(176809..177513)
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="ROD_01501"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86930"
FT                   /db_xref="GOA:D2TI34"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI34"
FT                   /protein_id="CBG86930.1"
FT                   /translation="MQFTPPLQRATLVQRYKRFLADVITPEGVELTIHCPNTGAMTGCA
FT                   DPGDTVWYSTSENTKRKYPHTWELTETRNGALICVNTLWANRLTKEAIEQGQVSELSGY
FT                   SVLRSEVKYGAERSRIDFMLQEDLRPDCYIEVKSVTLAENEKGYFPDAITQRGQKHLRE
FT                   LMNVAAEGKRAVIFFAVLHSAITRFSPARHIDAKYAQLLNEAQRKGVEVLAYKAELSAD
FT                   SMTLMESLPVTL"
     MQFTPPLQRA TLVQRYKRFL ADVITPEGVE LTIHCPNTGA MTGCADPGDT VWYSTSENTK        60
     RKYPHTWELT ETRNGALICV NTLWANRLTK EAIEQGQVSE LSGYSVLRSE VKYGAERSRI       120
     DFMLQEDLRP DCYIEVKSVT LAENEKGYFP DAITQRGQKH LRELMNVAAE GKRAVIFFAV       180
     LHSAITRFSP ARHIDAKYAQ LLNEAQRKGV EVLAYKAELS ADSMTLMESL PVTL             234
//

If you have problems or comments...

PBIL Back to PBIL home page