(data stored in ACNUC8465 zone)

EMBL: FN543502.THIL

FN543502.THIL        Location/Qualifiers
FT   CDS             518837..519814
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ROD_04661"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87245"
FT                   /db_xref="GOA:D2TL04"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL04"
FT                   /protein_id="CBG87245.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRRDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFMPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPEVDEAWLETFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGYVPVGRALKRAGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADDVDNAYLLQRHLRPTPRILQGQALRDLASAAIDLSDGLISDLG
FT                   HIVKASACGARIDVDALPYSQAMLRHVGAEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALAHLGVPFTCIGQMSADVEGICFIRDGEPVTFDWKGYDHFAAL"
     MACGEFSLIA RYFDRVRSSR RDVETGIGDD CALLNIPEKQ TLAISTDTLV AGNHFMPDID        60
     PADLAYKALA VNLSDLAAMG ADPAWLTLAL TLPEVDEAWL ETFSDSLFDL LNYYDMQLIG       120
     GDTTRGPLSM TLGIHGYVPV GRALKRAGAK PGDWIYVTGT PGDSAAGLAI LQNRLQVADD       180
     VDNAYLLQRH LRPTPRILQG QALRDLASAA IDLSDGLISD LGHIVKASAC GARIDVDALP       240
     YSQAMLRHVG AEQALRWALS GGEDYELCFT VPELNRGALD VALAHLGVPF TCIGQMSADV       300
     EGICFIRDGE PVTFDWKGYD HFAAL                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page