(data stored in ACNUC8465 zone)

EMBL: FN543502.THIP

FN543502.THIP        Location/Qualifiers
FT   CDS             complement(88467..90077)
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="ROD_00741"
FT                   /product="thiamine ABC transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00741"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86854"
FT                   /db_xref="GOA:D2TGH3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH3"
FT                   /protein_id="CBG86854.1"
FT                   /translation="MATRRQPLIPGWLLPGLTAAALMTAVALAAFLALWLNAPQGEWRS
FT                   LWQDDYLWHVVRFSFWQAFLSALLSVVPAIFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLWQAFGLEWTFSPYGLQGILLAHVFFNLPMATRLLLQSLE
FT                   NIPGEQRQLAAQLGIRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAMLALIQMICCLALVLLSQRLSKAIAPGATLIQGWRDP
FT                   DDRPHSRITDALLIVFALLLLLPPLLAVIADGLNRHLPEVLAQPILWQAIWTSLRIALA
FT                   AGLLCVALTMMLLWSSRELRARQRLLAGQTLELSGMLILAMPGIVLATGFFLLLNNSTG
FT                   LPESADGIVLFTNALMAIPYALKVLENPMRDITSRYSMLCQSLGIEGWQRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDNFRTLPFYLYQQIGSYRSQDGAVTALLLLLL
FT                   CFLLFTVIEKLPGRNVKTD"
     MATRRQPLIP GWLLPGLTAA ALMTAVALAA FLALWLNAPQ GEWRSLWQDD YLWHVVRFSF        60
     WQAFLSALLS VVPAIFLARA LYRRRFPGRL ALLRLCAMTL ILPVLVAVFG ILSVYGRQGW       120
     LASLWQAFGL EWTFSPYGLQ GILLAHVFFN LPMATRLLLQ SLENIPGEQR QLAAQLGIRG       180
     WHFFRFVEWP WLRRQIPPVA ALIFMLCFAS FATVLSLGGG PQATTIELAI YQALSYDYDP       240
     ARAAMLALIQ MICCLALVLL SQRLSKAIAP GATLIQGWRD PDDRPHSRIT DALLIVFALL       300
     LLLPPLLAVI ADGLNRHLPE VLAQPILWQA IWTSLRIALA AGLLCVALTM MLLWSSRELR       360
     ARQRLLAGQT LELSGMLILA MPGIVLATGF FLLLNNSTGL PESADGIVLF TNALMAIPYA       420
     LKVLENPMRD ITSRYSMLCQ SLGIEGWQRL KVVELRALKR PLAQALAFAC VLSIGDFGVV       480
     ALFGNDNFRT LPFYLYQQIG SYRSQDGAVT ALLLLLLCFL LFTVIEKLPG RNVKTD           536
//

If you have problems or comments...

PBIL Back to PBIL home page