(data stored in ACNUC8465 zone)

EMBL: FN543502.UHPC

FN543502.UHPC        Location/Qualifiers
FT   CDS             complement(457365..458669)
FT                   /transl_table=11
FT                   /gene="uhpC"
FT                   /locus_tag="ROD_04071"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87189"
FT                   /db_xref="GOA:D2TKU8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKU8"
FT                   /protein_id="CBG87189.1"
FT                   /translation="MHARQTTAIDQRYRALRLTLLLCMVTGYAAFYLTRKSVNYVLPAL
FT                   QTDLGLDKGDIGLLGSLFYLSYGLSKFTAGLWHDSHGQRGFMGAGLFATGVLNVAFAFG
FT                   ESLTLLLAVWTLNGFFQGWGWPPCARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLIS
FT                   AFAAHWWGWQAAMLTPGIISMALGIWLTLQLKGTPREEGLPSVGAWRNDPLELRQEQLS
FT                   PPMGLWRMLRITMLRNPMIWLLGGSYVLVYLIRIALNDWGNIWLTESHGVNLLSANATV
FT                   MLFEVGGLLGALFAGWGSDLLFSGQRAPMILLFTLGLMVSVAALWLAPVHHYALLAACF
FT                   FTVGFFVFGPQMLIGLAAVECGHKAAAGSITGFLGLFAYLGAALAGWPLSLVIERYDWS
FT                   GMFSLLSIAAVLMGLLLMPLLMAGVSATLSQRIKQ"
     MHARQTTAID QRYRALRLTL LLCMVTGYAA FYLTRKSVNY VLPALQTDLG LDKGDIGLLG        60
     SLFYLSYGLS KFTAGLWHDS HGQRGFMGAG LFATGVLNVA FAFGESLTLL LAVWTLNGFF       120
     QGWGWPPCAR LLTHWYSRNE RGFWWGCWNM SINIGGAIIP LISAFAAHWW GWQAAMLTPG       180
     IISMALGIWL TLQLKGTPRE EGLPSVGAWR NDPLELRQEQ LSPPMGLWRM LRITMLRNPM       240
     IWLLGGSYVL VYLIRIALND WGNIWLTESH GVNLLSANAT VMLFEVGGLL GALFAGWGSD       300
     LLFSGQRAPM ILLFTLGLMV SVAALWLAPV HHYALLAACF FTVGFFVFGP QMLIGLAAVE       360
     CGHKAAAGSI TGFLGLFAYL GAALAGWPLS LVIERYDWSG MFSLLSIAAV LMGLLLMPLL       420
     MAGVSATLSQ RIKQ                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page