(data stored in ACNUC1104 zone)

EMBL: FN667741.AMPH

FN667741.AMPH        Location/Qualifiers
FT   CDS             complement(453358..454575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="XBJ1_0450"
FT                   /product="beta-lactamase/D-ala carboxypeptidase,
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79600"
FT                   /db_xref="GOA:D3UW91"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79600.1"
FT                   /translation="MNKQLYKLFAVSALSWALSACAAPDNAHQNNFPQSGKKTTKWQVF
FT                   EGNDNTKKMASSLVDQYAQSIFDEGNPLGMAMVIIDNNQVVHRSFGETYPGSGARPRQD
FT                   SVIRLASITKLMTSEVMIKLAQKERLKITDPLQKYTYHGVRVPDYAITQPIRLYHLASH
FT                   TSGLPREQPGGKWGRPVFIWPTQSNRWAWLKTAGMNAAPGTTASYSNLAYDLLADALSK
FT                   ATGEPYTRLLQEEITRPYRMKDTTLTPSRSQCARLMEGVKPSPCLSTIAAAGSGGIYST
FT                   PVDMQRWMQQFLSSHNQLRKKTASREQGIYFKRENLTSITGMDVAGQADGIGLGWVYMD
FT                   AKKGVPGIYQKTGGGGGFNTYMAMIPEQNIGVFVVMTRKEQSKFSRVTNGVNELVAALS
FT                   RNHGKL"
     MNKQLYKLFA VSALSWALSA CAAPDNAHQN NFPQSGKKTT KWQVFEGNDN TKKMASSLVD        60
     QYAQSIFDEG NPLGMAMVII DNNQVVHRSF GETYPGSGAR PRQDSVIRLA SITKLMTSEV       120
     MIKLAQKERL KITDPLQKYT YHGVRVPDYA ITQPIRLYHL ASHTSGLPRE QPGGKWGRPV       180
     FIWPTQSNRW AWLKTAGMNA APGTTASYSN LAYDLLADAL SKATGEPYTR LLQEEITRPY       240
     RMKDTTLTPS RSQCARLMEG VKPSPCLSTI AAAGSGGIYS TPVDMQRWMQ QFLSSHNQLR       300
     KKTASREQGI YFKRENLTSI TGMDVAGQAD GIGLGWVYMD AKKGVPGIYQ KTGGGGGFNT       360
     YMAMIPEQNI GVFVVMTRKE QSKFSRVTNG VNELVAALSR NHGKL                       405
//

If you have problems or comments...

PBIL Back to PBIL home page