(data stored in ACNUC1104 zone)

EMBL: FN667741.ATPC

FN667741.ATPC        Location/Qualifiers
FT   CDS             complement(26215..26637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpC"
FT                   /locus_tag="XBJ1_0021"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   epsilon-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79176"
FT                   /db_xref="GOA:D3UXZ8"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79176.1"
FT                   /translation="MAAMTFFLNVVSAEKRLFEGLVQKIQVTGSEGELGIYPQHTPLLT
FT                   AIKPGMIRIVKQFGEEEFIYLSGGVLEVQPNGVIVLADTAIRGKDLDEAKALEAKREAE
FT                   EHVRNSHGDVDYAQASAELSKAIAKLRVIELTKQRM"
     MAAMTFFLNV VSAEKRLFEG LVQKIQVTGS EGELGIYPQH TPLLTAIKPG MIRIVKQFGE        60
     EEFIYLSGGV LEVQPNGVIV LADTAIRGKD LDEAKALEAK REAEEHVRNS HGDVDYAQAS       120
     AELSKAIAKL RVIELTKQRM                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page