(data stored in ACNUC1104 zone)

EMBL: FN667741.ATPD

FN667741.ATPD        Location/Qualifiers
FT   CDS             complement(26659..28041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpD"
FT                   /locus_tag="XBJ1_0022"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   beta-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79177"
FT                   /db_xref="GOA:D3UXZ9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79177.1"
FT                   /translation="MATGKIIQVIGAVVDVEFPQDSVPKVYNALEVKNSEEKLVLEVQQ
FT                   QLGGGIVRCIAMGTSDGLRRGLDAIDLGHPIEVPVGKATLGRIMNVLGDPIDMKGEIGE
FT                   EERWSIHRTAPSYEELSSSQELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   IRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVAL
FT                   TGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQE
FT                   RITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDS
FT                   TSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQR
FT                   FLSQPFFVAEVFTGSPGKFVSLKETIRGFKGILEGDYDHLPEQAFYMVGTIDEAVEKAK
FT                   KM"
     MATGKIIQVI GAVVDVEFPQ DSVPKVYNAL EVKNSEEKLV LEVQQQLGGG IVRCIAMGTS        60
     DGLRRGLDAI DLGHPIEVPV GKATLGRIMN VLGDPIDMKG EIGEEERWSI HRTAPSYEEL       120
     SSSQELLETG IKVMDLICPF AKGGKVGLFG GAGVGKTVNM MELIRNIAIE HSGYSVFAGV       180
     GERTREGNDF YHEMTDSNVL DKVSLVYGQM NEPPGNRLRV ALTGLTMAEK FRDEGRDVLL       240
     FVDNIYRYTL AGTEVSALLG RMPSAVGYQP TLAEEMGVLQ ERITSTKTGS ITSVQAVYVP       300
     ADDLTDPSPA TTFAHLDATV VLSRQIASLG IYPAVDPLDS TSRQLDPLVV GQEHYDVARG       360
     VQSILQRYQE LKDIIAILGM DELSEEDKLV VARARKIQRF LSQPFFVAEV FTGSPGKFVS       420
     LKETIRGFKG ILEGDYDHLP EQAFYMVGTI DEAVEKAKKM                             460
//

If you have problems or comments...

PBIL Back to PBIL home page