(data stored in ACNUC1104 zone)

EMBL: FN667741.ATPH

FN667741.ATPH        Location/Qualifiers
FT   CDS             complement(30555..31088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpH"
FT                   /locus_tag="XBJ1_0025"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   delta-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79180"
FT                   /db_xref="GOA:D3UY02"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79180.1"
FT                   /translation="MSEFATVARPYAKAAFDFAVEHQSLEHWQNMLAFVAEVTRNEQVG
FT                   ELLSGSLAPETLANTFITLCGEQVDEHAQNFIRVMAENGRLLVLPEVFQQFTQLRASLE
FT                   STINVEVISASELNEQQQAKISAAMEKRLSRKVKLNCKIDKSVIAGVVIRAGDMVIDGS
FT                   IRGRLDRLTDVLQS"
     MSEFATVARP YAKAAFDFAV EHQSLEHWQN MLAFVAEVTR NEQVGELLSG SLAPETLANT        60
     FITLCGEQVD EHAQNFIRVM AENGRLLVLP EVFQQFTQLR ASLESTINVE VISASELNEQ       120
     QQAKISAAME KRLSRKVKLN CKIDKSVIAG VVIRAGDMVI DGSIRGRLDR LTDVLQS          177
//

If you have problems or comments...

PBIL Back to PBIL home page