(data stored in ACNUC1104 zone)

EMBL: FN667741.BIOH

FN667741.BIOH        Location/Qualifiers
FT   CDS             146235..147011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="XBJ1_0145"
FT                   /product="putative enzyme in pimeloyl-CoA (biotin
FT                   precursor) synthesis with alpha/beta-hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79296"
FT                   /db_xref="GOA:D3UYB8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79296.1"
FT                   /translation="MNKLFWQIMGEAPRDLVMLHGWGLNSEVWRSVETRLSSHFRLHLV
FT                   DLPGHGRSQPYPAMTLAEMADTVWQQAPENALWLGWSLGGLVASRIALDHPAEVAGLIT
FT                   VASSPKFSAEGDWPGIKPTVLRAFEHQLSEDFQKTVERFLSLQTLGTDSARQDARLLKS
FT                   VILNQPMPTVEVLNAGLETLRTDDLRAELAQLQLPFLRLYGYLDGLVPRKIAAQLDNEW
FT                   PHTHSVIMRNAAHAPFVSHPDEFVDAVMEFVANAGL"
     MNKLFWQIMG EAPRDLVMLH GWGLNSEVWR SVETRLSSHF RLHLVDLPGH GRSQPYPAMT        60
     LAEMADTVWQ QAPENALWLG WSLGGLVASR IALDHPAEVA GLITVASSPK FSAEGDWPGI       120
     KPTVLRAFEH QLSEDFQKTV ERFLSLQTLG TDSARQDARL LKSVILNQPM PTVEVLNAGL       180
     ETLRTDDLRA ELAQLQLPFL RLYGYLDGLV PRKIAAQLDN EWPHTHSVIM RNAAHAPFVS       240
     HPDEFVDAVM EFVANAGL                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page