(data stored in ACNUC1104 zone)

EMBL: FN667741.CLPB

FN667741.CLPB        Location/Qualifiers
FT   CDS             279323..282037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /gene="clpB"
FT                   /locus_tag="XBJ1_0272"
FT                   /product="putative ClpA/B-type chaperone (Putative ATPase
FT                   with chaperone activity; probable component of SST VI
FT                   cluster)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79423"
FT                   /db_xref="GOA:D3UYP5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79423.1"
FT                   /translation="MIQIDLPTLVNRLNPMTRHALEAAAASCVSQQQPEITVAQLLFQM
FT                   IDTPLSDVRLILNKADIDKDLLKEQLDQMMPHHQAIVQTYPNFSPMLVEWLQDSWLLAS
FT                   TEMQHTELRGGVMLIALLFSPMRYLTPQPARMLAGINRELLRQNFTEWTNGSAEQPFSG
FT                   DDKNGQGVHPANSDSLLARFTQNMTEQARQGKLDPVLCRDNEIDLMIDILCRRRKNNPI
FT                   VVGEAGVGKSALIEGLALRIINDRVPDKLRHSELMTLDLGALQAGAAVKGEFEKRFKGI
FT                   MAEISQSSKPIILFIDEAHTLIGAGNQAGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPSAEEATVIMRGLRAIYEQAHGVLIDDEALKASAVLSDRY
FT                   LSGRQLPDKAIDVLDTACARVAINLTSPPRQISSLTTELHQMQMEIDVLKREQRMGLNE
FT                   HADRLEELQNQQVEIQEELVTLEKNWRQQQELVTQIIELRGQLLADSDESVAAETTDKT
FT                   IENAVEETAQDAKEQEAIAQDEPEAAADEQSLIEKLALLNAQLTELQQKQTLVSPHVDK
FT                   TQIASVIAEWTGVPLNRLSQSELSIVTELPTHLGQSIKGQDVAIQNLHKHLLTARADLR
FT                   RPGRPLGAFLLVGPSGVGKTETVLQIAELMFGGRQYLTTINMSEFQEKHTVSRLIGSPP
FT                   GYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGELADGEGRIIDCK
FT                   NVVFFLTSNLGYQTIVDHAEQPDQLNDLLYPELAAFFKPALLARMEVIPYLPLGHETLK
FT                   TIIQSKLARLDSLLSQRFNAEVTISDDVSEEILQRATRAENGARMLESIIDGALLPPVS
FT                   LLLLQKMAAGTAISAIRLTVAEHEFHAEVEEAE"
     MIQIDLPTLV NRLNPMTRHA LEAAAASCVS QQQPEITVAQ LLFQMIDTPL SDVRLILNKA        60
     DIDKDLLKEQ LDQMMPHHQA IVQTYPNFSP MLVEWLQDSW LLASTEMQHT ELRGGVMLIA       120
     LLFSPMRYLT PQPARMLAGI NRELLRQNFT EWTNGSAEQP FSGDDKNGQG VHPANSDSLL       180
     ARFTQNMTEQ ARQGKLDPVL CRDNEIDLMI DILCRRRKNN PIVVGEAGVG KSALIEGLAL       240
     RIINDRVPDK LRHSELMTLD LGALQAGAAV KGEFEKRFKG IMAEISQSSK PIILFIDEAH       300
     TLIGAGNQAG GLDISNLLKP ALARGELKTI AATTWSEYKK YFEKDAALSR RFQLVKVSEP       360
     SAEEATVIMR GLRAIYEQAH GVLIDDEALK ASAVLSDRYL SGRQLPDKAI DVLDTACARV       420
     AINLTSPPRQ ISSLTTELHQ MQMEIDVLKR EQRMGLNEHA DRLEELQNQQ VEIQEELVTL       480
     EKNWRQQQEL VTQIIELRGQ LLADSDESVA AETTDKTIEN AVEETAQDAK EQEAIAQDEP       540
     EAAADEQSLI EKLALLNAQL TELQQKQTLV SPHVDKTQIA SVIAEWTGVP LNRLSQSELS       600
     IVTELPTHLG QSIKGQDVAI QNLHKHLLTA RADLRRPGRP LGAFLLVGPS GVGKTETVLQ       660
     IAELMFGGRQ YLTTINMSEF QEKHTVSRLI GSPPGYVGYG EGGVLTEAIR QKPYSVVLLD       720
     EVEKAHPDVL NLFYQAFDKG ELADGEGRII DCKNVVFFLT SNLGYQTIVD HAEQPDQLND       780
     LLYPELAAFF KPALLARMEV IPYLPLGHET LKTIIQSKLA RLDSLLSQRF NAEVTISDDV       840
     SEEILQRATR AENGARMLES IIDGALLPPV SLLLLQKMAA GTAISAIRLT VAEHEFHAEV       900
     EEAE                                                                    904
//

If you have problems or comments...

PBIL Back to PBIL home page