(data stored in ACNUC1104 zone)

EMBL: FN667741.DAMX

FN667741.DAMX        Location/Qualifiers
FT   CDS             complement(63611..64576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0011"
FT                   /gene="damX"
FT                   /locus_tag="XBJ1_0056"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79207"
FT                   /db_xref="GOA:D3UY29"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79207.1"
FT                   /translation="MDELKSENKQKTENEFKPDTSDRHPPRSRSQSNQPKLAVSRQQLM
FT                   IGVGILVLLLLIIAISSALKSPTEHEKQQSQNTAEKNIDLSGSSSLSTNNQNSSPENPL
FT                   ASAINGSQEISMPPISNTPSKDLSPAPEASNHNQRIELPGDISDALNQQQGNINNTVQK
FT                   NLTPSQSNPMQQTVIPPVEQNKTEKVAPPKIEKTEKVAKSEKHAKSTDKPAIFHHQASK
FT                   KSVTDTRGDLLKASANRFTLQLSSASRSDTLIAFAKNNNLSNYTVYEAKREGKAWFILI
FT                   HGSYGSVSDAKSAISSLPAEVQAKKPWVRKLQQVQQDLKK"
     MDELKSENKQ KTENEFKPDT SDRHPPRSRS QSNQPKLAVS RQQLMIGVGI LVLLLLIIAI        60
     SSALKSPTEH EKQQSQNTAE KNIDLSGSSS LSTNNQNSSP ENPLASAING SQEISMPPIS       120
     NTPSKDLSPA PEASNHNQRI ELPGDISDAL NQQQGNINNT VQKNLTPSQS NPMQQTVIPP       180
     VEQNKTEKVA PPKIEKTEKV AKSEKHAKST DKPAIFHHQA SKKSVTDTRG DLLKASANRF       240
     TLQLSSASRS DTLIAFAKNN NLSNYTVYEA KREGKAWFIL IHGSYGSVSD AKSAISSLPA       300
     EVQAKKPWVR KLQQVQQDLK K                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page