(data stored in ACNUC1104 zone)

EMBL: FN667741.DNAN

FN667741.DNAN        Location/Qualifiers
FT   CDS             1552..2652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0001"
FT                   /gene="dnaN"
FT                   /locus_tag="XBJ1_0002"
FT                   /product="DNA polymerase III, beta-subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79157"
FT                   /db_xref="GOA:D3UXX9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79157.1"
FT                   /translation="MKFIIEREQLLKPLQQVSSPLGGRPTLPILGNLLLQVTESSLLLT
FT                   GTDLEMEMKARVALTQPHEQGATTIPARKFFDIWRGLPDGAEISVELDGDRILVRSGRS
FT                   RFSLSTLPASDFPNLDDWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETE
FT                   EEELRTVATDGHRLAVCSMNIGQNLPSHSVIVPRKGVIELMRLLDGGDSLLQLQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEANCDVLKQAFSRAAILSNEKFRGV
FT                   RIYLSENQLRITANNPEQEEAEEIVDVSYQGTEMEIGFNVSYVLDVLNALKCEQVSLLL
FT                   TDATSSVKIENSASQAATYVVMPMRL"
     MKFIIEREQL LKPLQQVSSP LGGRPTLPIL GNLLLQVTES SLLLTGTDLE MEMKARVALT        60
     QPHEQGATTI PARKFFDIWR GLPDGAEISV ELDGDRILVR SGRSRFSLST LPASDFPNLD       120
     DWQSEVEFSL PQATLKRLIE STQFSMAHQD VRYYLNGMLF ETEEEELRTV ATDGHRLAVC       180
     SMNIGQNLPS HSVIVPRKGV IELMRLLDGG DSLLQLQIGS NNIRAHVGDF IFTSKLVDGR       240
     FPDYRRVLPK NPDKTLEANC DVLKQAFSRA AILSNEKFRG VRIYLSENQL RITANNPEQE       300
     EAEEIVDVSY QGTEMEIGFN VSYVLDVLNA LKCEQVSLLL TDATSSVKIE NSASQAATYV       360
     VMPMRL                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page