(data stored in ACNUC1104 zone)

EMBL: FN667741.DPPB

FN667741.DPPB        Location/Qualifiers
FT   CDS             251104..252123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0050"
FT                   /gene="dppB"
FT                   /locus_tag="XBJ1_0247"
FT                   /product="dipeptide transport protein 1 (ABC superfamily,
FT                   membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79398"
FT                   /db_xref="GOA:D3UYM0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79398.1"
FT                   /translation="MLQFILRRLGMVIPTFIGITLLTFAFVHMIPGDPVLIMAGERGVS
FT                   AERHAELMAAMGLDKPLWEQYFHYINGIFHGDLGISLKSRIPVWDEFVPRFKATLELGV
FT                   CAMLLAISVGIPVGVLAAVKRGSVFDHTAVGVSLTGYSMPIFWWGIMLIMLVSVQWNLT
FT                   PVSGRISDSVFLDDSYPLTGFMLIDTLFWGEEGDFIDAVMHMLLPAVVLGTIPLAVIVR
FT                   MTRSAMLEVLGEDYIRTARAKGLSRMRVIIIHALRNALLPVVTVIGLQVGIMLAGAILT
FT                   ETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLVVDLLYGVVNPRIRHKK"
     MLQFILRRLG MVIPTFIGIT LLTFAFVHMI PGDPVLIMAG ERGVSAERHA ELMAAMGLDK        60
     PLWEQYFHYI NGIFHGDLGI SLKSRIPVWD EFVPRFKATL ELGVCAMLLA ISVGIPVGVL       120
     AAVKRGSVFD HTAVGVSLTG YSMPIFWWGI MLIMLVSVQW NLTPVSGRIS DSVFLDDSYP       180
     LTGFMLIDTL FWGEEGDFID AVMHMLLPAV VLGTIPLAVI VRMTRSAMLE VLGEDYIRTA       240
     RAKGLSRMRV IIIHALRNAL LPVVTVIGLQ VGIMLAGAIL TETIFSWPGL GRWLIDALQR       300
     RDYPVVQGGV LLVATMIILV NLVVDLLYGV VNPRIRHKK                              339
//

If you have problems or comments...

PBIL Back to PBIL home page