(data stored in ACNUC1104 zone)

EMBL: FN667741.DPPD

FN667741.DPPD        Location/Qualifiers
FT   CDS             253047..254027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0050"
FT                   /gene="dppD"
FT                   /locus_tag="XBJ1_0249"
FT                   /product="dipeptide transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79400"
FT                   /db_xref="GOA:D3UYM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79400.1"
FT                   /translation="MALLNVDQLSVHFGEENAPFRAVDRISYSVEQGQVVGVVGESGSG
FT                   KSVSSLAIMGLVDYPGRVMAEKLEFNGRDLTKISEKERRQLVGAEVAMIFQDPMTSLNP
FT                   CYTVGFQIIEALKVHQGGSRKTRYQRAVDLLTLVGIPDPASRLDVYPHQLSGGMSQRVM
FT                   IAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQQENMALVLITHDLALVAEAAH
FT                   HIIVMYGGQVVEAGKATEIFRAPRHPYTQALLRALPEFSTDKSRLASLPGVVPGKYDRP
FT                   TGCLLNPRCPYANEHCRQVEPALKTVGESQVKCHMPLDDEGRPTV"
     MALLNVDQLS VHFGEENAPF RAVDRISYSV EQGQVVGVVG ESGSGKSVSS LAIMGLVDYP        60
     GRVMAEKLEF NGRDLTKISE KERRQLVGAE VAMIFQDPMT SLNPCYTVGF QIIEALKVHQ       120
     GGSRKTRYQR AVDLLTLVGI PDPASRLDVY PHQLSGGMSQ RVMIAMAIAC RPKLLIADEP       180
     TTALDVTIQA QIIELLLELQ QQENMALVLI THDLALVAEA AHHIIVMYGG QVVEAGKATE       240
     IFRAPRHPYT QALLRALPEF STDKSRLASL PGVVPGKYDR PTGCLLNPRC PYANEHCRQV       300
     EPALKTVGES QVKCHMPLDD EGRPTV                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page