(data stored in ACNUC1104 zone)

EMBL: FN667741.FEOB

FN667741.FEOB        Location/Qualifiers
FT   CDS             complement(158393..160705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0034"
FT                   /gene="feoB"
FT                   /locus_tag="XBJ1_0164"
FT                   /product="ferrous iron transport protein B (FeoB family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79315"
FT                   /db_xref="GOA:D3UYD7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79315.1"
FT                   /translation="MKQLTIGLIGNPNAGKTTLFNQLTGSRQRVGNWAGVTVERKTGRF
FT                   TTDEQQIELVDLPGTYSLTTISEQTSIDEQIACHYILSGEADMLINVVDASNLERNLYL
FT                   SLQLIELGIPCIVALNMLDIAKNQHINIDIAALEQRLGCPVIPLVSTRATGIDTLKKAI
FT                   DHYQPSSQPVRIEYPDSLLQEVNHLASQITQNFNPQQRRWLTLQVLEGDIYSRERAGLT
FT                   QSQLAESKMRLQQQQLDEPELVIADSRYQAINALCLAVIDTHAATPHKLTQVMDKVILN
FT                   RWLGVPIFLFVMYLMFVLAINLGGALQPIFDGASTAIFIDGMRWLGHTLHFPDWLTVFL
FT                   AQGVGGGINTVLPLVPQIGLMYLFLSFLEDSGYMARAAFVMDRLMQSLGLPGKSFVPLI
FT                   VGFGCNVPSVMGSRTLDAPRERLITIMMAPFMSCGARLAIFAVFAAAFFGKSGASIVFS
FT                   LYILGITVAVLTGLLLKHTLMRGEASPFVMELPVYHVPHAKTLLLQSWQRLKGFVIRAG
FT                   KVIVAASILIGALNSFSFSGKAVDNINESALASVSKVITPLLYPIGVHSDNWQATVGLI
FT                   TGAMAKEVVVGTLNTLYTAENLNQAPFNPDEFHLLNELKGAVAETWDSLKETFTLSALS
FT                   NPIEASKGDGNMDSGAMGTMSAKFGSAISAYSYLIFVLLYVPCVSVMGAIARETSRGWM
FT                   LFSILWGLDVAYSLAAVFYQVTTFSAHPQSSLITILAVIVFNVLVFIGLRRARSRVTMT
FT                   FNNTAGRSCECSNGSCH"
     MKQLTIGLIG NPNAGKTTLF NQLTGSRQRV GNWAGVTVER KTGRFTTDEQ QIELVDLPGT        60
     YSLTTISEQT SIDEQIACHY ILSGEADMLI NVVDASNLER NLYLSLQLIE LGIPCIVALN       120
     MLDIAKNQHI NIDIAALEQR LGCPVIPLVS TRATGIDTLK KAIDHYQPSS QPVRIEYPDS       180
     LLQEVNHLAS QITQNFNPQQ RRWLTLQVLE GDIYSRERAG LTQSQLAESK MRLQQQQLDE       240
     PELVIADSRY QAINALCLAV IDTHAATPHK LTQVMDKVIL NRWLGVPIFL FVMYLMFVLA       300
     INLGGALQPI FDGASTAIFI DGMRWLGHTL HFPDWLTVFL AQGVGGGINT VLPLVPQIGL       360
     MYLFLSFLED SGYMARAAFV MDRLMQSLGL PGKSFVPLIV GFGCNVPSVM GSRTLDAPRE       420
     RLITIMMAPF MSCGARLAIF AVFAAAFFGK SGASIVFSLY ILGITVAVLT GLLLKHTLMR       480
     GEASPFVMEL PVYHVPHAKT LLLQSWQRLK GFVIRAGKVI VAASILIGAL NSFSFSGKAV       540
     DNINESALAS VSKVITPLLY PIGVHSDNWQ ATVGLITGAM AKEVVVGTLN TLYTAENLNQ       600
     APFNPDEFHL LNELKGAVAE TWDSLKETFT LSALSNPIEA SKGDGNMDSG AMGTMSAKFG       660
     SAISAYSYLI FVLLYVPCVS VMGAIARETS RGWMLFSILW GLDVAYSLAA VFYQVTTFSA       720
     HPQSSLITIL AVIVFNVLVF IGLRRARSRV TMTFNNTAGR SCECSNGSCH                  770
//

If you have problems or comments...

PBIL Back to PBIL home page