(data stored in ACNUC1104 zone)

EMBL: FN667741.FLIY

FN667741.FLIY        Location/Qualifiers
FT   CDS             complement(438324..439097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0085"
FT                   /gene="fliY"
FT                   /locus_tag="XBJ1_0430"
FT                   /product="cysteine transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79580"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79580.1"
FT                   /translation="MKAFLSLLLAGATALTISAPSYAGKDLDAIKASGVFKVGTEGTYP
FT                   PFTYHDQANKLTGFDVDIAREVARRLNVKPEFMEVKWDGLIAGLDAKRFDAVINQVGVT
FT                   PEREAKYSFSIPYTASQVVLITRDNNSDIKTFADIKGKRSAQSLTSNYGQLATSNGAHL
FT                   VSTDGFNQAIDLVATGRADATLNDRLSFLDFKKQRPDAPVKIVAQQADASKSAVLLRKG
FT                   DPELIAVINKALQDMKDDGTYARISEKYFGTDISK"
     MKAFLSLLLA GATALTISAP SYAGKDLDAI KASGVFKVGT EGTYPPFTYH DQANKLTGFD        60
     VDIAREVARR LNVKPEFMEV KWDGLIAGLD AKRFDAVINQ VGVTPEREAK YSFSIPYTAS       120
     QVVLITRDNN SDIKTFADIK GKRSAQSLTS NYGQLATSNG AHLVSTDGFN QAIDLVATGR       180
     ADATLNDRLS FLDFKKQRPD APVKIVAQQA DASKSAVLLR KGDPELIAVI NKALQDMKDD       240
     GTYARISEKY FGTDISK                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page