(data stored in ACNUC1104 zone)

EMBL: FN667741.FRDD

FN667741.FRDD        Location/Qualifiers
FT   CDS             complement(537071..537424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0106"
FT                   /gene="frdD"
FT                   /locus_tag="XBJ1_0534"
FT                   /product="fumarate reductase, anaerobic, membrane anchor
FT                   polypeptide"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79678"
FT                   /db_xref="GOA:D3UZ96"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79678.1"
FT                   /translation="MNQRPKRSDEPIFWGLFGAGGMWSAIVGPAMVLLLGFLIPLGLAP
FT                   EALSYDRVLTFCQSFIGRIFLLLMISLPLWCGMHRLHHGMHDLQIHIPASKGVFYGTAA
FT                   ILSVVALIGVFTL"
     MNQRPKRSDE PIFWGLFGAG GMWSAIVGPA MVLLLGFLIP LGLAPEALSY DRVLTFCQSF        60
     IGRIFLLLMI SLPLWCGMHR LHHGMHDLQI HIPASKGVFY GTAAILSVVA LIGVFTL          117
//

If you have problems or comments...

PBIL Back to PBIL home page