(data stored in ACNUC1104 zone)

EMBL: FN667741.FRE

FN667741.FRE         Location/Qualifiers
FT   CDS             516177..516878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0101"
FT                   /gene="fre"
FT                   /locus_tag="XBJ1_0515"
FT                   /product="flavin reductase, FAD = preferred substrate"
FT                   /EC_number="1.5.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79664"
FT                   /db_xref="GOA:D3UZ82"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79664.1"
FT                   /translation="MTTLSCKVTSVDSITDTVYRVHLLPDSPFSFRAGQYLMVVMDERD
FT                   KRPFSMASPPSEKQTIELHIGASELNLYAMAVMDRILDQRVIDIDIPHGQAWFREDSEN
FT                   PMLLIAGGTGFSYTRSILLSALEKNPNRDISIYWGGRELHHLYDLGELQGLSECYPNLA
FT                   VVPVVEQVDEYWQGRTGTVLSAVLEDFGSLANHDIYIAGRFEMAKIARERFCSERDASI
FT                   DRMYGDAFEFI"
     MTTLSCKVTS VDSITDTVYR VHLLPDSPFS FRAGQYLMVV MDERDKRPFS MASPPSEKQT        60
     IELHIGASEL NLYAMAVMDR ILDQRVIDID IPHGQAWFRE DSENPMLLIA GGTGFSYTRS       120
     ILLSALEKNP NRDISIYWGG RELHHLYDLG ELQGLSECYP NLAVVPVVEQ VDEYWQGRTG       180
     TVLSAVLEDF GSLANHDIYI AGRFEMAKIA RERFCSERDA SIDRMYGDAF EFI              233
//

If you have problems or comments...

PBIL Back to PBIL home page