(data stored in ACNUC1104 zone)

EMBL: FN667741.FTSE

FN667741.FTSE        Location/Qualifiers
FT   CDS             557632..558297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0109"
FT                   /gene="ftsE"
FT                   /locus_tag="XBJ1_0554"
FT                   /product="putative transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79698"
FT                   /db_xref="GOA:D3UZB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79698.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLLPGEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGHIWFGGHDISRLKTRETPFLRRQIGMIFQDHHLLLDRTVYENVAMPL
FT                   IISGASAEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPTVLLADE
FT                   PTGNLDGELSEGIMRLFEEFNRVGVTVLMATHDVALIERRNYRILTLNQGRMQGGHHG"
     MIRFEQVSKA YLGGRQALQG VDFHLLPGEM AFLTGHSGAG KSTLLKLICG IERPSAGHIW        60
     FGGHDISRLK TRETPFLRRQ IGMIFQDHHL LLDRTVYENV AMPLIISGAS AEDIRRRVSA       120
     ALDKVGLLDK AKNFPIQLSG GEQQRVGIAR AVVNKPTVLL ADEPTGNLDG ELSEGIMRLF       180
     EEFNRVGVTV LMATHDVALI ERRNYRILTL NQGRMQGGHH G                           221
//

If you have problems or comments...

PBIL Back to PBIL home page