(data stored in ACNUC1104 zone)

EMBL: FN667741.FTSX

FN667741.FTSX        Location/Qualifiers
FT   CDS             558290..559270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0109"
FT                   /gene="ftsX"
FT                   /locus_tag="XBJ1_0555"
FT                   /product="integral membrane cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79699"
FT                   /db_xref="GOA:D3UZB7"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79699.1"
FT                   /translation="MVKNVRHSAKKMTPPKPKSKSLKGGWRVQQRYAWKSTLSDMLRQP
FT                   LATLLTIMVIAISLTLPSVFYIVWKNVNQAVEQWYPVPQLTVYLDKSLNDGGARQVIEQ
FT                   LKVIDGVKSVNYLSREEAENEFRAWSGFAGALNLLEENPLPAVAIISPQMDFQDSTVLT
FT                   TLRDRVSQIKGIEEVRMDESWFTRLTALANLIGQIAAVIGILMVVALLLVIGNSVRLSI
FT                   FSRRETINVMKLIGATDGFILRPFLNGGVLLGGLGAIFSLILSSLLVWKLSNVVTDVAG
FT                   VFGTTFKLYGLGWDESLLLVLISGMIGWLAAWFATIQHLRRFRPE"
     MVKNVRHSAK KMTPPKPKSK SLKGGWRVQQ RYAWKSTLSD MLRQPLATLL TIMVIAISLT        60
     LPSVFYIVWK NVNQAVEQWY PVPQLTVYLD KSLNDGGARQ VIEQLKVIDG VKSVNYLSRE       120
     EAENEFRAWS GFAGALNLLE ENPLPAVAII SPQMDFQDST VLTTLRDRVS QIKGIEEVRM       180
     DESWFTRLTA LANLIGQIAA VIGILMVVAL LLVIGNSVRL SIFSRRETIN VMKLIGATDG       240
     FILRPFLNGG VLLGGLGAIF SLILSSLLVW KLSNVVTDVA GVFGTTFKLY GLGWDESLLL       300
     VLISGMIGWL AAWFATIQHL RRFRPE                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page