(data stored in ACNUC1104 zone)

EMBL: FN667741.FTSY

FN667741.FTSY        Location/Qualifiers
FT   CDS             556228..557625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0109"
FT                   /gene="ftsY"
FT                   /locus_tag="XBJ1_0553"
FT                   /product="cell division protein: membrane binding
FT                   (N-terminal); GTPase domain (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79697"
FT                   /db_xref="GOA:D3UZB5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79697.1"
FT                   /translation="MAEEQKKGFFSWFGRGRQEKKQQEEQLEQDKSAAEEAEQQRLAEE
FT                   AARRAAEEAEQQRLAEEAARRAAEEAEQQRLAEEAARRAAEEAEQQRLAEEAARRAAEE
FT                   AEQQRLAEEAAHHAAEEAEQQRLAEEAARRAAEEAEQQRLIEESSILPKEQDRPSKEGF
FT                   FARLKRSLVKTRQNLGSGFLGLFSGKKIDDDLFEELEEQLLVADVGVETTRKIINNLTA
FT                   HASRKELKDAEALYTKLKEEMSDILAKVDKPLDIEGKSPYVILMVGVNGVGKTTTIGKL
FT                   ARQYQSQGKSVMLAAGDTFRAAAVEQLQVWGERNKIPVIAQHTGADPASVIFDAIQSAK
FT                   AKGVDILIADTAGRLQNKSHLMEELKKIVRVMRKLDEETPHEIMLTLDACTGQNAVSQA
FT                   KLFHEAVGLTGISLTKLDGTAKGGVIFAIADQFDIPIRYIGVGEGIEDLRPFKADDFIE
FT                   ALFARED"
     MAEEQKKGFF SWFGRGRQEK KQQEEQLEQD KSAAEEAEQQ RLAEEAARRA AEEAEQQRLA        60
     EEAARRAAEE AEQQRLAEEA ARRAAEEAEQ QRLAEEAARR AAEEAEQQRL AEEAAHHAAE       120
     EAEQQRLAEE AARRAAEEAE QQRLIEESSI LPKEQDRPSK EGFFARLKRS LVKTRQNLGS       180
     GFLGLFSGKK IDDDLFEELE EQLLVADVGV ETTRKIINNL TAHASRKELK DAEALYTKLK       240
     EEMSDILAKV DKPLDIEGKS PYVILMVGVN GVGKTTTIGK LARQYQSQGK SVMLAAGDTF       300
     RAAAVEQLQV WGERNKIPVI AQHTGADPAS VIFDAIQSAK AKGVDILIAD TAGRLQNKSH       360
     LMEELKKIVR VMRKLDEETP HEIMLTLDAC TGQNAVSQAK LFHEAVGLTG ISLTKLDGTA       420
     KGGVIFAIAD QFDIPIRYIG VGEGIEDLRP FKADDFIEAL FARED                       465
//

If you have problems or comments...

PBIL Back to PBIL home page