(data stored in ACNUC1104 zone)

EMBL: FN667741.GLTS

FN667741.GLTS        Location/Qualifiers
FT   CDS             230064..231278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="XBJ1_0230"
FT                   /product="glutamate transport protein (GltS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79381"
FT                   /db_xref="GOA:D3UYK3"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79381.1"
FT                   /translation="MYQMDIYGTLVAATLVLLLGRKLVQSIPFLEKYTIPEPVAGGLLV
FT                   AIVLLAVKQSTDWEISFDLSLKDPLMLMFFATIGLNANLASLKAGGKFLVLFVFVVIGL
FT                   LLVQNTVGIALAKMLGLDPLMGLLAGSITLSGGHGTGAAWGKVFSERYGFDNATEVAMA
FT                   CATFGLILGGLIGGPVARFLVKNTKAPGLGVDDAEIPTAFEKPYTGRMITPLVMLETIA
FT                   LISICLLAGSYIEKQLEHTMFELPTFVCVLFVGVILSNGLSLLGFYRVFDRAVSVLGNV
FT                   SLSLFLAMALMSLKLWQLASLALPMLVILVVQSIVMALYAIFVTYRVMGKNYDASILSA
FT                   GHCGFGLGATPTAIANMQAITDRCGPSHMAFLLVPMVGAFFIDIVNAAVIKIYLLLPIF
FT                   PSIAG"
     MYQMDIYGTL VAATLVLLLG RKLVQSIPFL EKYTIPEPVA GGLLVAIVLL AVKQSTDWEI        60
     SFDLSLKDPL MLMFFATIGL NANLASLKAG GKFLVLFVFV VIGLLLVQNT VGIALAKMLG       120
     LDPLMGLLAG SITLSGGHGT GAAWGKVFSE RYGFDNATEV AMACATFGLI LGGLIGGPVA       180
     RFLVKNTKAP GLGVDDAEIP TAFEKPYTGR MITPLVMLET IALISICLLA GSYIEKQLEH       240
     TMFELPTFVC VLFVGVILSN GLSLLGFYRV FDRAVSVLGN VSLSLFLAMA LMSLKLWQLA       300
     SLALPMLVIL VVQSIVMALY AIFVTYRVMG KNYDASILSA GHCGFGLGAT PTAIANMQAI       360
     TDRCGPSHMA FLLVPMVGAF FIDIVNAAVI KIYLLLPIFP SIAG                        404
//

If you have problems or comments...

PBIL Back to PBIL home page