(data stored in ACNUC1104 zone)

EMBL: FN667741.GLYQ

FN667741.GLYQ        Location/Qualifiers
FT   CDS             245408..246316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0049"
FT                   /gene="glyQ"
FT                   /locus_tag="XBJ1_0243"
FT                   /product="glycine tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79394"
FT                   /db_xref="GOA:D3UYL6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79394.1"
FT                   /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPIAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKA
FT                   LGLDPTVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEV
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDIYHQNEVEQSTYNFEHADVDFLFTC
FT                   FEQYEKEAQELLALEAPLPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTK
FT                   SVAEAYYASREALGFPMCKKN"
     MQKFDTKTFQ GLILTLQDYW ARQGCTIVQP LDMEVGAGTS HPMTCLRALG PEPIAAAYVQ        60
     PSRRPTDGRY GENPNRLQHY YQFQVIIKPS PDNIQELYLG SLKALGLDPT VHDIRFVEDN       120
     WENPTLGAWG LGWEVWLNGM EVTQFTYFQQ VGGLECKPVT GEVTYGLERL AMYIQGVDSV       180
     YDLVWSDGPL GKTTYGDIYH QNEVEQSTYN FEHADVDFLF TCFEQYEKEA QELLALEAPL       240
     PLPAYERILK AGHTFNLLDA RKAISVTERQ RYILRIRTLT KSVAEAYYAS REALGFPMCK       300
     KN                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page