(data stored in ACNUC1104 zone)

EMBL: FN667741.GMK

FN667741.GMK         Location/Qualifiers
FT   CDS             complement(236118..236741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0048"
FT                   /gene="gmk"
FT                   /locus_tag="XBJ1_0235"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79386"
FT                   /db_xref="GOA:D3UYK8"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79386.1"
FT                   /translation="MNQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRPTR
FT                   PGENHGEHYFFVTVDEFQNMISHDEFLEYAGVFGNYYGTSRKIIEDTLASGVDVFLDID
FT                   WQGAQQVRQKMPAARSIFILPPSKEELLRRLRGRGQDSDEVIDKRMSQAVAEMEHYGEY
FT                   DYVIINDDFNTALADLQSIIRSERIRLDRQAQRHDALISKLLAG"
     MNQGTLYIVS APSGAGKSSL IQALLKTQPL YDTQVSVSHT TRPTRPGENH GEHYFFVTVD        60
     EFQNMISHDE FLEYAGVFGN YYGTSRKIIE DTLASGVDVF LDIDWQGAQQ VRQKMPAARS       120
     IFILPPSKEE LLRRLRGRGQ DSDEVIDKRM SQAVAEMEHY GEYDYVIIND DFNTALADLQ       180
     SIIRSERIRL DRQAQRHDAL ISKLLAG                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page