(data stored in ACNUC1104 zone)

EMBL: FN667741.GNTX

FN667741.GNTX        Location/Qualifiers
FT   CDS             complement(145513..146196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0029"
FT                   /gene="gntX"
FT                   /locus_tag="XBJ1_0144"
FT                   /product="putative periplasmic gluconate-binding protein in
FT                   GNT I transport system"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79295"
FT                   /db_xref="GOA:D3UYB7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79295.1"
FT                   /translation="MLTMVGYCWLCHQSLYFAHHGICHICHQQLKRLKHVCPRCALPAE
FT                   SRDFPCGRCLKNPPPWQHLIAITDYAPPLSRLIRRYKYHGTPQLATVLARLFLLHWLQG
FT                   YRDGRWNKPDCILGIPLHSKKRWRRGFDQIELIAKPLSRWLQCHYQPDLLWRSRATLTQ
FT                   RGLSATQRKTNLKHAFQLRGDFTDQNVAIFDDVITTGTTLHEASQLLIRAGAHSVQAWA
FT                   ICRTL"
     MLTMVGYCWL CHQSLYFAHH GICHICHQQL KRLKHVCPRC ALPAESRDFP CGRCLKNPPP        60
     WQHLIAITDY APPLSRLIRR YKYHGTPQLA TVLARLFLLH WLQGYRDGRW NKPDCILGIP       120
     LHSKKRWRRG FDQIELIAKP LSRWLQCHYQ PDLLWRSRAT LTQRGLSATQ RKTNLKHAFQ       180
     LRGDFTDQNV AIFDDVITTG TTLHEASQLL IRAGAHSVQA WAICRTL                     227
//

If you have problems or comments...

PBIL Back to PBIL home page