(data stored in ACNUC1104 zone)

EMBL: FN667741.GYRB

FN667741.GYRB        Location/Qualifiers
FT   CDS             3781..6195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0001"
FT                   /gene="gyrB"
FT                   /locus_tag="XBJ1_0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79159"
FT                   /db_xref="GOA:D3UXY1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79159.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGHCDKILVTIHTDNSVSVQDDGRGIPTGIHEEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELIIRRDGKVHEQTYQHGVPQAPLKTVGDTEQT
FT                   GTTVRFWPSMDTFKLNTEFEYDILAKRLRELSFLNSGVSIRLVDKRTNAEDHFHYEGGI
FT                   KAFVEFLSRNKTPIHPNVFYFSTEKDGIGVEISMQWNDGFQENIYCFTNNIPQRDGGAH
FT                   LVGFRAAMTRTLNSYMDKEGYNKKSKINATGDDAREGLIAVISVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVETQMNEKLVEYLLENPNDAKTVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGYVYIAQPPLYKVKKGKQEQYIKDDDAMEAYQMSIALDGASLYTNQYAPALK
FT                   GEALEKLVTEFNASNKIIKRMERLYPQALLNNLIYHPTLTEDALNDQAKVEEWVSTLAI
FT                   SLNDKEQNGSTYSYQIHENRERQIYEPVLCIRTHGVDTNYNLDFDFIHGGEYRRITKLG
FT                   ELIGNLIEEGAYIERGERRQLVSNFEQALEWLTKESRRGLSIQRYKGLGEMNPDQLWET
FT                   TMNPETRRMMRVTVKDAIATDLLFTTLMGDAVEPRRAFIEENALKAANIDI"
     MSNTYDSSSI KVLKGLDAVR KRPGMYIGDT DDGTGLHHMV FEVVDNAIDE ALAGHCDKIL        60
     VTIHTDNSVS VQDDGRGIPT GIHEEEGVSA AEVIMTVLHA GGKFDDNSYK VSGGLHGVGV       120
     SVVNALSEKL ELIIRRDGKV HEQTYQHGVP QAPLKTVGDT EQTGTTVRFW PSMDTFKLNT       180
     EFEYDILAKR LRELSFLNSG VSIRLVDKRT NAEDHFHYEG GIKAFVEFLS RNKTPIHPNV       240
     FYFSTEKDGI GVEISMQWND GFQENIYCFT NNIPQRDGGA HLVGFRAAMT RTLNSYMDKE       300
     GYNKKSKINA TGDDAREGLI AVISVKVPDP KFSSQTKDKL VSSEVKTAVE TQMNEKLVEY       360
     LLENPNDAKT VVGKIIDAAR AREAARKARE MTRRKGALDL AGLPGKLADC QERDPALSEL       420
     YLVEGDSAGG SAKQGRNRKN QAILPLKGKI LNVEKARFDK MLSSQEVATL ITALGCGIGR       480
     DEYNPDKLRY HSIIIMTDAD VDGSHIRTLL LTFFYRQMPE IIERGYVYIA QPPLYKVKKG       540
     KQEQYIKDDD AMEAYQMSIA LDGASLYTNQ YAPALKGEAL EKLVTEFNAS NKIIKRMERL       600
     YPQALLNNLI YHPTLTEDAL NDQAKVEEWV STLAISLNDK EQNGSTYSYQ IHENRERQIY       660
     EPVLCIRTHG VDTNYNLDFD FIHGGEYRRI TKLGELIGNL IEEGAYIERG ERRQLVSNFE       720
     QALEWLTKES RRGLSIQRYK GLGEMNPDQL WETTMNPETR RMMRVTVKDA IATDLLFTTL       780
     MGDAVEPRRA FIEENALKAA NIDI                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page