(data stored in ACNUC1104 zone)

EMBL: FN667741.HFLX

FN667741.HFLX        Location/Qualifiers
FT   CDS             331605..332885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0065"
FT                   /gene="hflX"
FT                   /locus_tag="XBJ1_0322"
FT                   /product="putative GTPase subunit of protease with
FT                   nucleoside triP hydrolase domain, together with HflC-HflK
FT                   involved in stability of phage lambda cII repressor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79472"
FT                   /db_xref="GOA:D3UYU4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79472.1"
FT                   /translation="MFDRYEGGELAVLVHVFFSQEKDTENLSEFESLVTSAGVSPVQIV
FT                   TGSRKAPNPKYFVGEGKAEEIAEAVKNSGADVVLFNHALSPAQERNLERLCQCRVVDRT
FT                   GVILDIFAQRARTHEGKLQVELAQLRHLSTRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDKIKQILGRLGKVEKQREQGRQARNKADIPTVSLVGYTNAGKSSLFNRITSAEV
FT                   YTADQLFATLDPTLRRIDVNDVGTVVLADTVGFIRHLPHDLVAAFKATLQETRQARLLL
FT                   HVVDAADSRLDENIVAVDSVLEEIEANEIPSLLVMNKIDMLEDFVPRIDRDEENRPIRV
FT                   WLSAQTGAGIPLLFQVLTECLSGEIAHYELHLPPEAGRLRSRFYQLQAIEREWIEDGGQ
FT                   IGIEVRMPMVDWRRLCKQELNLLDYVV"
     MFDRYEGGEL AVLVHVFFSQ EKDTENLSEF ESLVTSAGVS PVQIVTGSRK APNPKYFVGE        60
     GKAEEIAEAV KNSGADVVLF NHALSPAQER NLERLCQCRV VDRTGVILDI FAQRARTHEG       120
     KLQVELAQLR HLSTRLVRGW THLERQKGGI GLRGPGETQL ETDRRLLRDK IKQILGRLGK       180
     VEKQREQGRQ ARNKADIPTV SLVGYTNAGK SSLFNRITSA EVYTADQLFA TLDPTLRRID       240
     VNDVGTVVLA DTVGFIRHLP HDLVAAFKAT LQETRQARLL LHVVDAADSR LDENIVAVDS       300
     VLEEIEANEI PSLLVMNKID MLEDFVPRID RDEENRPIRV WLSAQTGAGI PLLFQVLTEC       360
     LSGEIAHYEL HLPPEAGRLR SRFYQLQAIE REWIEDGGQI GIEVRMPMVD WRRLCKQELN       420
     LLDYVV                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page