(data stored in ACNUC1104 zone)

EMBL: FN667741.HOLC

FN667741.HOLC        Location/Qualifiers
FT   CDS             complement(448671..449135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0088"
FT                   /gene="holC"
FT                   /locus_tag="XBJ1_0445"
FT                   /product="DNA polymerase III, chi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79595"
FT                   /db_xref="GOA:D3UW86"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79595.1"
FT                   /translation="MKNATFYLLEKLSQEQLSSSDELQPHEWLACQLAADQWRAGKRVL
FT                   IACESQQQAEKLDEALWQREPSQFVPHNLAGEGPRYGAPVELCWPQKRSNAPRDILVTL
FT                   LPHFADFATAFHEVIDFVPIDENLKQLARERYKVYRSVSFNLTMATPPTY"
     MKNATFYLLE KLSQEQLSSS DELQPHEWLA CQLAADQWRA GKRVLIACES QQQAEKLDEA        60
     LWQREPSQFV PHNLAGEGPR YGAPVELCWP QKRSNAPRDI LVTLLPHFAD FATAFHEVID       120
     FVPIDENLKQ LARERYKVYR SVSFNLTMAT PPTY                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page