(data stored in ACNUC1104 zone)

EMBL: FN667741.HSLO

FN667741.HSLO        Location/Qualifiers
FT   CDS             77818..78690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0014"
FT                   /gene="hslO"
FT                   /locus_tag="XBJ1_0070"
FT                   /product="heat shock protein 33, redox regulated chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79221"
FT                   /db_xref="GOA:D3UY43"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79221.1"
FT                   /translation="MTKHDQLHRFLFESHSVRGELVSVSETYQRMMENHHYPLPVQQLL
FT                   GELLVATSLLTATLKFNGDITVQIQGDGPVRLAVINGNNQQQMRGTARIDGDVDAASSL
FT                   RDMVGNGYMVITVTPTEGERYQGVVALEGETLAECLDAYFKQSEQLPTRLFIRTGILDG
FT                   KMAAGGMLLQILPGAQEGSEDLLDHLVQLTATIKGEELFTLDVKEILHRLYHEEDVTLY
FT                   EPQQVEFRCTCSHQRCADTLVTLPDADLQEILLKDGKIDMECEFCGMHYIFNDKDISEI
FT                   KIVKKELLH"
     MTKHDQLHRF LFESHSVRGE LVSVSETYQR MMENHHYPLP VQQLLGELLV ATSLLTATLK        60
     FNGDITVQIQ GDGPVRLAVI NGNNQQQMRG TARIDGDVDA ASSLRDMVGN GYMVITVTPT       120
     EGERYQGVVA LEGETLAECL DAYFKQSEQL PTRLFIRTGI LDGKMAAGGM LLQILPGAQE       180
     GSEDLLDHLV QLTATIKGEE LFTLDVKEIL HRLYHEEDVT LYEPQQVEFR CTCSHQRCAD       240
     TLVTLPDADL QEILLKDGKI DMECEFCGMH YIFNDKDISE IKIVKKELLH                  290
//

If you have problems or comments...

PBIL Back to PBIL home page