(data stored in ACNUC1104 zone)

EMBL: FN667741.HSLR

FN667741.HSLR        Location/Qualifiers
FT   CDS             77378..77791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0014"
FT                   /gene="hslR"
FT                   /locus_tag="XBJ1_0069"
FT                   /product="heat shock protein 15, DNA/RNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79220"
FT                   /db_xref="GOA:D3UY42"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79220.1"
FT                   /translation="MPNSDTDQTMRLDKWLWAARFYKTRSIAREMIDGGKVHYNGQRSK
FT                   PSKLVELNAEIKLRQGNEEKIVTVLALNSHRRSATEAQQLYQETEKSIINREKTALARK
FT                   MNVLTMPHPDRRPDKKERRTLIKFKNTKLNEPE"
     MPNSDTDQTM RLDKWLWAAR FYKTRSIARE MIDGGKVHYN GQRSKPSKLV ELNAEIKLRQ        60
     GNEEKIVTVL ALNSHRRSAT EAQQLYQETE KSIINREKTA LARKMNVLTM PHPDRRPDKK       120
     ERRTLIKFKN TKLNEPE                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page