(data stored in ACNUC1104 zone)

EMBL: FN667741.HSRA

FN667741.HSRA        Location/Qualifiers
FT   CDS             complement(47940..49322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsrA"
FT                   /locus_tag="XBJ1_0043"
FT                   /product="putative transport protein (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79198"
FT                   /db_xref="GOA:D3UY20"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79198.1"
FT                   /translation="MVKSARSMSGLPWIAAIAFFMQSLDATILNTALPAIAKSLNHHPL
FT                   AMQPAIVSYTLTVAMLIPVSGWLADRFGTQRIFIYAVSLFSLGSLACALSSSFSFLVAA
FT                   RVIQGIGGAMMMPVARLALLRAYPRSELLPVLNFVTMPGLLGPILGPMLGGLLVTYATW
FT                   HWIFIINIPIGLLGIIYAKKHMPNFTMPKCFFDFLGFMLFSVGLVMLSVSFDLFGNNTL
FT                   PNYVPVAVMAGSIIMLSGYIFHAKRHPNPLIDLQLFQTRTFSVGITSNIATRLSTGSLS
FT                   FLIPLMLQVGFGYSAVIAGIMMAPNAIGAILAKSFVTKLLTQFGYRNTLIWVTVIIGVM
FT                   IAQFSLQTPEISLVFLIIPLFVLGMAMSTQFTSMNTITLGDLNNNNASAGNSLLAVTQQ
FT                   LSISLGVTVSAAILRFYESAEYGSTVDHFHYTFITIGVITLASSFVFLLLKKEDGRNLI
FT                   KK"
     MVKSARSMSG LPWIAAIAFF MQSLDATILN TALPAIAKSL NHHPLAMQPA IVSYTLTVAM        60
     LIPVSGWLAD RFGTQRIFIY AVSLFSLGSL ACALSSSFSF LVAARVIQGI GGAMMMPVAR       120
     LALLRAYPRS ELLPVLNFVT MPGLLGPILG PMLGGLLVTY ATWHWIFIIN IPIGLLGIIY       180
     AKKHMPNFTM PKCFFDFLGF MLFSVGLVML SVSFDLFGNN TLPNYVPVAV MAGSIIMLSG       240
     YIFHAKRHPN PLIDLQLFQT RTFSVGITSN IATRLSTGSL SFLIPLMLQV GFGYSAVIAG       300
     IMMAPNAIGA ILAKSFVTKL LTQFGYRNTL IWVTVIIGVM IAQFSLQTPE ISLVFLIIPL       360
     FVLGMAMSTQ FTSMNTITLG DLNNNNASAG NSLLAVTQQL SISLGVTVSA AILRFYESAE       420
     YGSTVDHFHY TFITIGVITL ASSFVFLLLK KEDGRNLIKK                             460
//

If you have problems or comments...

PBIL Back to PBIL home page