(data stored in ACNUC1104 zone)

EMBL: FN667741.INFB

FN667741.INFB        Location/Qualifiers
FT   CDS             374677..377451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0074"
FT                   /gene="infB"
FT                   /locus_tag="XBJ1_0368"
FT                   /product="protein chain initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79518"
FT                   /db_xref="GOA:D3UYZ0"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79518.1"
FT                   /translation="MTEVTVKLLAEEIQTSVERLIQQFADAGIQKTATDSVSQREKESL
FT                   LAHLNREQGGSGGQPGKLTLQRKTRSTLNVPGTGGKSKSVAIEVRKKRTYVNRDAIEQS
FT                   PTEEQAKREAEEQARREVEEKARLETEAKKFAEEQAKRDAEEQAKREAAKSAQREAEEK
FT                   AKREGVDMTQREAAEKEKVTKQHTENKPKSVQTEPAVQSEKARREAEAANLKRKAEEEV
FT                   RRKVEAEAKRVAEEARRMAEENKDKWSETAEPSENTDDYHVTTSQHARAAEDENDAKVE
FT                   GDRRTRSRGGKATRQKKNNKHSESKADREEARAVGRNKGKQRKPSTLQQSFTKPVAAVN
FT                   RDVVIGETITVAELANKMAVKGSQVIKTMMKMGAMATINQVIDQETAQLVAEEMGHKVI
FT                   LRRENELEEALMSDRDTGETLAESRAPVVTIMGHVDHGKTSLLDYIRSTKVASGEAGGI
FT                   TQHIGAYHVQTEKGMITFLDTPGHAAFTSMRARGAKATDIVVLVVAADDGVMPQTVEAI
FT                   QHAKAANVPVVVAVNKIDKPDADPDRVKNELTQYGIIPEEWGGENQFMSVSAKAGLGID
FT                   ELLECILLQAELLELNAVRTGMANGVVIESFLDKGRGPVATILVQSGTLNKGDIVLCGF
FT                   EYGRIRAMRDELGLEVTSAGPSIPVEILGLSSVPSAGDEATVVRDEKKAREVALYRQGK
FT                   FREVKLARQQKSKLENMFANMEEGKVSELNIVLKTDVQGTCEAICDSLLKLSTDEVKVK
FT                   IIGSGVGGITETDATLAAASNAIILGFNVRADASARRIIESESVDLRYYSVIYSLIDEI
FT                   KQAMSGMLAPEYKQQIMGLAEVRDVFKSPKFGAIAGCMVTEGSIKRNNPIRVLRDNVVI
FT                   YEGELESLRRFKDDVNEVRNGMECGIGVKNYNDVRVGDMIEVFEIIEIKRSIV"
     MTEVTVKLLA EEIQTSVERL IQQFADAGIQ KTATDSVSQR EKESLLAHLN REQGGSGGQP        60
     GKLTLQRKTR STLNVPGTGG KSKSVAIEVR KKRTYVNRDA IEQSPTEEQA KREAEEQARR       120
     EVEEKARLET EAKKFAEEQA KRDAEEQAKR EAAKSAQREA EEKAKREGVD MTQREAAEKE       180
     KVTKQHTENK PKSVQTEPAV QSEKARREAE AANLKRKAEE EVRRKVEAEA KRVAEEARRM       240
     AEENKDKWSE TAEPSENTDD YHVTTSQHAR AAEDENDAKV EGDRRTRSRG GKATRQKKNN       300
     KHSESKADRE EARAVGRNKG KQRKPSTLQQ SFTKPVAAVN RDVVIGETIT VAELANKMAV       360
     KGSQVIKTMM KMGAMATINQ VIDQETAQLV AEEMGHKVIL RRENELEEAL MSDRDTGETL       420
     AESRAPVVTI MGHVDHGKTS LLDYIRSTKV ASGEAGGITQ HIGAYHVQTE KGMITFLDTP       480
     GHAAFTSMRA RGAKATDIVV LVVAADDGVM PQTVEAIQHA KAANVPVVVA VNKIDKPDAD       540
     PDRVKNELTQ YGIIPEEWGG ENQFMSVSAK AGLGIDELLE CILLQAELLE LNAVRTGMAN       600
     GVVIESFLDK GRGPVATILV QSGTLNKGDI VLCGFEYGRI RAMRDELGLE VTSAGPSIPV       660
     EILGLSSVPS AGDEATVVRD EKKAREVALY RQGKFREVKL ARQQKSKLEN MFANMEEGKV       720
     SELNIVLKTD VQGTCEAICD SLLKLSTDEV KVKIIGSGVG GITETDATLA AASNAIILGF       780
     NVRADASARR IIESESVDLR YYSVIYSLID EIKQAMSGML APEYKQQIMG LAEVRDVFKS       840
     PKFGAIAGCM VTEGSIKRNN PIRVLRDNVV IYEGELESLR RFKDDVNEVR NGMECGIGVK       900
     NYNDVRVGDM IEVFEIIEIK RSIV                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page