(data stored in ACNUC1104 zone)

EMBL: FN667741.METI

FN667741.METI        Location/Qualifiers
FT   CDS             complement(634303..634956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0122"
FT                   /gene="metI"
FT                   /locus_tag="XBJ1_0614"
FT                   /product="D-and L-methionine transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79758"
FT                   /db_xref="GOA:D3UWI4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79758.1"
FT                   /translation="MSDGMIFLLFKGVWETLVMTFVSGFFGFVIGLPIGVLLYVTRAGQ
FT                   IMENITLYRILSALVNIGRSIPFIILLVWMIPFTRLIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPPGLIEAARAMGATPLQIVKKILLPEAQLSLINAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNAPVMNTVLALLIVLVFLIQLGGDRLIIAVNHK"
     MSDGMIFLLF KGVWETLVMT FVSGFFGFVI GLPIGVLLYV TRAGQIMENI TLYRILSALV        60
     NIGRSIPFII LLVWMIPFTR LIVGTSIGLQ AAIVPLTVGA APFIARMVEN ALLEIPPGLI       120
     EAARAMGATP LQIVKKILLP EAQLSLINAA TITLITLVGY SAMGGAVGAG GLGQIGYQYG       180
     YIGYNAPVMN TVLALLIVLV FLIQLGGDRL IIAVNHK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page