(data stored in ACNUC1104 zone)

EMBL: FN667741.METN

FN667741.METN        Location/Qualifiers
FT   CDS             complement(634949..635980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0122"
FT                   /gene="metN"
FT                   /locus_tag="XBJ1_0615"
FT                   /product="D-and L-methionine transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79759"
FT                   /db_xref="GOA:D3UWI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79759.1"
FT                   /translation="MIKLTQINKVFQLGTRSINALSNINLHVPQGQIYGVIGSSGAGKS
FT                   TLIRCVNMLERPTSGKVLVNGQDLTSMSNRELTHARRHIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKNEINKRVSELLELVGLSDKHDAYPANLSGGQKQRVAIARALANSPKILL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDQVAVINAGLLIEQ
FT                   DVVSEIFSHPKTPVAQEFIKSTLHIDIPESYLKKLKPECTPDSLPLLKLEFTGKSVDAP
FT                   LISMAVRRFNIDVSILSSQMDYAGGVKFGVMLAELGGEYSSIESTIEFLKEHHVKVEVL
FT                   GYV"
     MIKLTQINKV FQLGTRSINA LSNINLHVPQ GQIYGVIGSS GAGKSTLIRC VNMLERPTSG        60
     KVLVNGQDLT SMSNRELTHA RRHIGMIFQH FNLLSSRTVF GNVALPLELD NTPKNEINKR       120
     VSELLELVGL SDKHDAYPAN LSGGQKQRVA IARALANSPK ILLCDEATSA LDPATTRSIL       180
     ELLKDINRRL GLTILLITHE MDVVKRICDQ VAVINAGLLI EQDVVSEIFS HPKTPVAQEF       240
     IKSTLHIDIP ESYLKKLKPE CTPDSLPLLK LEFTGKSVDA PLISMAVRRF NIDVSILSSQ       300
     MDYAGGVKFG VMLAELGGEY SSIESTIEFL KEHHVKVEVL GYV                         343
//

If you have problems or comments...

PBIL Back to PBIL home page