(data stored in ACNUC1104 zone)

EMBL: FN667741.MIOC

FN667741.MIOC        Location/Qualifiers
FT   CDS             complement(36666..37106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0007"
FT                   /gene="mioC"
FT                   /locus_tag="XBJ1_0032"
FT                   /product="FMN-binding protein, required for biotin synthase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79187"
FT                   /db_xref="GOA:D3UY09"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79187.1"
FT                   /translation="MSTITLISGSTMGSSEYVAEHMAEILENHGFSTEVLHGPSLDDLR
FT                   LGGLWLVVTSTHGAGDLPENLQPLADTIAQQQPDLSNVTFGAVGIGSSEYDIFCGAIKS
FT                   FEHLLKDRGAKRIGDRLEIDIQKYEIPEDPAEDWVKEWAKLL"
     MSTITLISGS TMGSSEYVAE HMAEILENHG FSTEVLHGPS LDDLRLGGLW LVVTSTHGAG        60
     DLPENLQPLA DTIAQQQPDL SNVTFGAVGI GSSEYDIFCG AIKSFEHLLK DRGAKRIGDR       120
     LEIDIQKYEI PEDPAEDWVK EWAKLL                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page