(data stored in ACNUC1104 zone)

EMBL: FN667741.MUTL

FN667741.MUTL        Location/Qualifiers
FT   CDS             328219..330162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0064"
FT                   /gene="mutL"
FT                   /locus_tag="XBJ1_0319"
FT                   /product="enzyme in methyl-directed mismatch repair,
FT                   stimulates binding of Vsr and MutS to heteroduplex DNA"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79469"
FT                   /db_xref="GOA:D3UYU1"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79469.1"
FT                   /translation="MAIRILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIE
FT                   IERGGAKLIRIRDNGCGIDQQDLTLALARHATSKIASLDDLEAIVSMGFRGEALASISS
FT                   VSRLTLTSRTESQTEAWQAYAEGRDMEVTVKPAAHPVGTTVEVLDLFYNTPARRKFLRT
FT                   EKTEFGHLDEVVRRIALARLDVAINLHHNGKLVRQYRPAKEESQHERRLAAICGMAFVQ
FT                   QALALSWQHDSLSIKGWVADPMSDTVGGDIQYCYVNGRMMRDRLINHAIRQAYQDLLQG
FT                   EKQPAYVLYLEIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQGVAAVLKQRGKGAELAL
FT                   GCEEPAASWVPENRLSAGENHFLQQNTASLKASPPSRAAAAPSVSSGGHDKEQPQLDRP
FT                   HSGNDTRQLHHGENYQKKQGELYQKMMQSAPEEKRPLFPERAVSVREKAAPIPVGAALL
FT                   QGKNISYSFGKVLSIHAASYALIESPLGIGLLSLPVAERWLKQVQLTPGELGLKSQPLL
FT                   IPLKLSLSQAEIDALKQNSELLKTFGIESTVAHGKVTIHAVSLPLRQQNLPKLLPELLN
FT                   YLVEQPSACAEQVAIWLSRHVGSEHETWNIAQAVQLLADVERLCPQLVESPPEGLLQLI
FT                   DLQAVVALLNHE"
     MAIRILPPQL ANQIAAGEVV ERPASVVKEL VENSLDAGAT RIDIEIERGG AKLIRIRDNG        60
     CGIDQQDLTL ALARHATSKI ASLDDLEAIV SMGFRGEALA SISSVSRLTL TSRTESQTEA       120
     WQAYAEGRDM EVTVKPAAHP VGTTVEVLDL FYNTPARRKF LRTEKTEFGH LDEVVRRIAL       180
     ARLDVAINLH HNGKLVRQYR PAKEESQHER RLAAICGMAF VQQALALSWQ HDSLSIKGWV       240
     ADPMSDTVGG DIQYCYVNGR MMRDRLINHA IRQAYQDLLQ GEKQPAYVLY LEIDPHQVDV       300
     NVHPAKHEVR FHQARLVHDF IYQGVAAVLK QRGKGAELAL GCEEPAASWV PENRLSAGEN       360
     HFLQQNTASL KASPPSRAAA APSVSSGGHD KEQPQLDRPH SGNDTRQLHH GENYQKKQGE       420
     LYQKMMQSAP EEKRPLFPER AVSVREKAAP IPVGAALLQG KNISYSFGKV LSIHAASYAL       480
     IESPLGIGLL SLPVAERWLK QVQLTPGELG LKSQPLLIPL KLSLSQAEID ALKQNSELLK       540
     TFGIESTVAH GKVTIHAVSL PLRQQNLPKL LPELLNYLVE QPSACAEQVA IWLSRHVGSE       600
     HETWNIAQAV QLLADVERLC PQLVESPPEG LLQLIDLQAV VALLNHE                     647
//

If you have problems or comments...

PBIL Back to PBIL home page