(data stored in ACNUC1104 zone)

EMBL: FN667741.OBGE

FN667741.OBGE        Location/Qualifiers
FT   CDS             362639..363817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0071"
FT                   /gene="obgE"
FT                   /locus_tag="XBJ1_0357"
FT                   /product="putative GTP-binding protein with nucleoside triP
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79507"
FT                   /db_xref="GOA:D3UYX9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79507.1"
FT                   /translation="MKFVDEASILVVAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRGCTGRRGQDITIKVPVGTRVRDIATGEV
FT                   LADMVRHEQRQMVAKGGFHGLGNTRFKSSVNRAPRQKTMGTPGESRELMLELMLLADVG
FT                   MLGMPNAGKSTFIRSVSAAKPKVADYPFTTLVPSLGVVRMDNEQSFVVADIPGLIEGAS
FT                   EGVGLGIRFLKHLERCRVLLHLIDLCPLDESDPVENARIIIKELHKYSEKLAEKPRWLV
FT                   FNKVDLTDPEEAKQRAKAIADELGWEGDYYMISAVNRQGVKELCWDIMEFMKAQPRHMD
FT                   VEAEAQPEKVEFMWDDYHKEQLQQSSDADVDDDLDDDWDEGDEEGIEFIYKH"
     MKFVDEASIL VVAGDGGNGC VSFRREKYIP KGGPDGGDGG DGGDVYLLAD ENLNTLIDYR        60
     FEKSFRAERG QNGQSRGCTG RRGQDITIKV PVGTRVRDIA TGEVLADMVR HEQRQMVAKG       120
     GFHGLGNTRF KSSVNRAPRQ KTMGTPGESR ELMLELMLLA DVGMLGMPNA GKSTFIRSVS       180
     AAKPKVADYP FTTLVPSLGV VRMDNEQSFV VADIPGLIEG ASEGVGLGIR FLKHLERCRV       240
     LLHLIDLCPL DESDPVENAR IIIKELHKYS EKLAEKPRWL VFNKVDLTDP EEAKQRAKAI       300
     ADELGWEGDY YMISAVNRQG VKELCWDIME FMKAQPRHMD VEAEAQPEKV EFMWDDYHKE       360
     QLQQSSDADV DDDLDDDWDE GDEEGIEFIY KH                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page