(data stored in ACNUC1104 zone)

EMBL: FN667741.PAAA

FN667741.PAAA        Location/Qualifiers
FT   CDS             complement(128766..129707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaA"
FT                   /locus_tag="XBJ1_0127"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation with ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79278"
FT                   /db_xref="GOA:D3UYA0"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79278.1"
FT                   /translation="MTTNSLQAHFDAKIAADLSIEAKDWMPDAYRQNLIRQIGQHAHSE
FT                   IVGMLPEANWITRAPTLRRKAVLLAKVQDEAGHGLYLYSAAETLGCTRQDIYQKLLNGK
FT                   MKYSSIFNYPTLNWADVGVIGWLVDGAAIINQVALCRASYGPYARAMVKICKEESFHQR
FT                   QGYEAVMVLAAGNDAQRKMLQDAINRFWWPTLMMFGPNDNDSPNSAQSMAWKIKRFSND
FT                   ELRQKFIDSTVPQLEALGMTAPDPELVWDATTEHYRFGEIDWDEFYQVLKGQGICNHER
FT                   LEAKRRAWETGSWVREAASIHAKKMATRKNAA"
     MTTNSLQAHF DAKIAADLSI EAKDWMPDAY RQNLIRQIGQ HAHSEIVGML PEANWITRAP        60
     TLRRKAVLLA KVQDEAGHGL YLYSAAETLG CTRQDIYQKL LNGKMKYSSI FNYPTLNWAD       120
     VGVIGWLVDG AAIINQVALC RASYGPYARA MVKICKEESF HQRQGYEAVM VLAAGNDAQR       180
     KMLQDAINRF WWPTLMMFGP NDNDSPNSAQ SMAWKIKRFS NDELRQKFID STVPQLEALG       240
     MTAPDPELVW DATTEHYRFG EIDWDEFYQV LKGQGICNHE RLEAKRRAWE TGSWVREAAS       300
     IHAKKMATRK NAA                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page