(data stored in ACNUC1104 zone)

EMBL: FN667741.PAAB

FN667741.PAAB        Location/Qualifiers
FT   CDS             complement(128434..128721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaB"
FT                   /locus_tag="XBJ1_0126"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79277"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79277.1"
FT                   /translation="MSDTDWPLYEVFIRSKQGLAHRHVGSLHAADDQMALENARDVYTR
FT                   RNEGCSIWVVKSIHLVASQPEERGAFFDPSEDKIYRHPTFYTIPDGIKNM"
     MSDTDWPLYE VFIRSKQGLA HRHVGSLHAA DDQMALENAR DVYTRRNEGC SIWVVKSIHL        60
     VASQPEERGA FFDPSEDKIY RHPTFYTIPD GIKNM                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page