(data stored in ACNUC1104 zone)

EMBL: FN667741.PAAC

FN667741.PAAC        Location/Qualifiers
FT   CDS             complement(127647..128423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaC"
FT                   /locus_tag="XBJ1_0125"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79276"
FT                   /db_xref="GOA:D3UY98"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79276.1"
FT                   /translation="MNTHSVDPSNHDLLNYVLRQGDTPLILAQRLCEWCGHAPELEIDL
FT                   ALSNIGLDLLGQARHFLSYAATLYGMDFDEDRLAFGRDEREYRNLLLVEQPNGGFNDTL
FT                   VRQFFIDAYHVLLHQALGQSRDPQLAAISTKSLKEVEYHLRFSRGWMIRLGDGTELSRE
FT                   KIRQSVNQLWRFTGELFYCDEVEQRLAEEGIAVDPRTLYEPWRQIINETFAQATLEIPQ
FT                   ETPYRQGGKQGLHTEHLGYMLAEMQYLQRTYPNCNW"
     MNTHSVDPSN HDLLNYVLRQ GDTPLILAQR LCEWCGHAPE LEIDLALSNI GLDLLGQARH        60
     FLSYAATLYG MDFDEDRLAF GRDEREYRNL LLVEQPNGGF NDTLVRQFFI DAYHVLLHQA       120
     LGQSRDPQLA AISTKSLKEV EYHLRFSRGW MIRLGDGTEL SREKIRQSVN QLWRFTGELF       180
     YCDEVEQRLA EEGIAVDPRT LYEPWRQIIN ETFAQATLEI PQETPYRQGG KQGLHTEHLG       240
     YMLAEMQYLQ RTYPNCNW                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page