(data stored in ACNUC1104 zone)

EMBL: FN667741.PAAD

FN667741.PAAD        Location/Qualifiers
FT   CDS             complement(127108..127617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaD"
FT                   /locus_tag="XBJ1_0124"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79275"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79275.1"
FT                   /translation="MEQHVNTLQLQNPAIHQIWQCLHQIADPELPVLSITDLGMVRAVT
FT                   PQLTGWRVTFTPTYSGCPATEYLINEIQQTLARAGFTSVTVEISLRPAWTTDWMNADAK
FT                   QRLREFGIAPPQGLACEKPTETETITCPRCGSHETEKISEFGSTACKAIYRCQQCLEPF
FT                   DYFKCI"
     MEQHVNTLQL QNPAIHQIWQ CLHQIADPEL PVLSITDLGM VRAVTPQLTG WRVTFTPTYS        60
     GCPATEYLIN EIQQTLARAG FTSVTVEISL RPAWTTDWMN ADAKQRLREF GIAPPQGLAC       120
     EKPTETETIT CPRCGSHETE KISEFGSTAC KAIYRCQQCL EPFDYFKCI                   169
//

If you have problems or comments...

PBIL Back to PBIL home page