(data stored in ACNUC1104 zone)

EMBL: FN667741.PAAE

FN667741.PAAE        Location/Qualifiers
FT   CDS             complement(126003..127088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaE"
FT                   /locus_tag="XBJ1_0123"
FT                   /product="putative phenylacetic acid degradation protein
FT                   with NADP-linked, 2Fe-2S ferredoxin-like and riboflavin
FT                   synthase-like domains"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79274"
FT                   /db_xref="GOA:D3UY96"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011884"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79274.1"
FT                   /translation="MATFHRPTFHRLSIAAIERETPDAVTVTLHVPDELKALFCYQPGQ
FT                   HLTLKARVDGAELRRCYSICSSPLDDGLQIGVKATYQGRFSTFINQRLKVGDELDVMQP
FT                   QGNFGHHPDGNNAGNYLAIAAGSGITPILSIIKSTLALEPDSTFTLIYGNRTSRSVMFK
FT                   EALADLKNRYLHRFQVLYLFSQEITDSPMFNGRIDSEHLQHLGKILLNFSQFGQAFLCG
FT                   PAAMLDDAKSALEQAGMASERIHTERFNTGRNPSSTAARPANLAERSETRVEIHLDGRT
FT                   LNIAMNTEDDSILDAALRQGADLPYACKGGVCATCKCRLKSGEVDMNVNYSLEPDQLAA
FT                   GYILSCQSWPKGDGVVVDFDV"
     MATFHRPTFH RLSIAAIERE TPDAVTVTLH VPDELKALFC YQPGQHLTLK ARVDGAELRR        60
     CYSICSSPLD DGLQIGVKAT YQGRFSTFIN QRLKVGDELD VMQPQGNFGH HPDGNNAGNY       120
     LAIAAGSGIT PILSIIKSTL ALEPDSTFTL IYGNRTSRSV MFKEALADLK NRYLHRFQVL       180
     YLFSQEITDS PMFNGRIDSE HLQHLGKILL NFSQFGQAFL CGPAAMLDDA KSALEQAGMA       240
     SERIHTERFN TGRNPSSTAA RPANLAERSE TRVEIHLDGR TLNIAMNTED DSILDAALRQ       300
     GADLPYACKG GVCATCKCRL KSGEVDMNVN YSLEPDQLAA GYILSCQSWP KGDGVVVDFD       360
     V                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page