(data stored in ACNUC1104 zone)

EMBL: FN667741.PAGC

FN667741.PAGC        Location/Qualifiers
FT   CDS             485086..485673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pagC"
FT                   /locus_tag="XBJ1_0486"
FT                   /product="Virulence membrane protein pagC precursor"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79635"
FT                   /db_xref="GOA:D3UWC6"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79635.1"
FT                   /translation="MVIKKALLATLAVSGVMYGSLAYADSHTVTVGYAQSKVQNFKDIR
FT                   GVNLHYRYEWDSPVSIIGSFTHMKGDRDYKFSFKHNGKNYTGEDSLDMKYYSLMAGPAY
FT                   RINDYLSVYGLLGFAHSKADATEGAYHLRNTVEVEASKMNRKSTNFAYGAGVEVNPIQS
FT                   LSLYAGYEGASVKYNDNREEINGFNLGVGYRF"
     MVIKKALLAT LAVSGVMYGS LAYADSHTVT VGYAQSKVQN FKDIRGVNLH YRYEWDSPVS        60
     IIGSFTHMKG DRDYKFSFKH NGKNYTGEDS LDMKYYSLMA GPAYRINDYL SVYGLLGFAH       120
     SKADATEGAY HLRNTVEVEA SKMNRKSTNF AYGAGVEVNP IQSLSLYAGY EGASVKYNDN       180
     REEINGFNLG VGYRF                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page