(data stored in ACNUC1104 zone)

EMBL: FN667741.PE101

FN667741.PE101       Location/Qualifiers
FT   CDS             111988..112518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0020"
FT                   /locus_tag="XBJ1_0105"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79256"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79256.1"
FT                   /translation="MKYLIGLCVIFFSLTVFSKQDELDFKAWEKKGSWGIYSEKPNSHF
FT                   KPLKIKSYKEGYLPAFSYLIKRFNLQNVNNQYCLIGYKWNKTKNSDERENIIVFWKTAN
FT                   YLINWNLPDSEDDDSYKAIIFSKPFIDMSESVVPYKESEGAQALWAKEGVIQMMNDCEL
FT                   NGQKITITPSGVR"
     MKYLIGLCVI FFSLTVFSKQ DELDFKAWEK KGSWGIYSEK PNSHFKPLKI KSYKEGYLPA        60
     FSYLIKRFNL QNVNNQYCLI GYKWNKTKNS DERENIIVFW KTANYLINWN LPDSEDDDSY       120
     KAIIFSKPFI DMSESVVPYK ESEGAQALWA KEGVIQMMND CELNGQKITI TPSGVR           176
//

If you have problems or comments...

PBIL Back to PBIL home page