(data stored in ACNUC1104 zone)

EMBL: FN667741.PE102

FN667741.PE102       Location/Qualifiers
FT   CDS             complement(112701..113294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0021"
FT                   /locus_tag="XBJ1_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79257"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79257.1"
FT                   /translation="MKVPYFSQWESFHLANDIIHHQLPLSHDPLWEQSGADSPEEYAKW
FT                   ANHICGMACLKMLLAARSGKIYPLLKLTKMATEYGAYQIEDEHIKGMIYAPVVSMLSEQ
FT                   FGIISQIVTGMTAEKIHEVFTQDSLYIASVHPSIRWPTRLPEKKGGHLVLVTNATPEEI
FT                   TFHNPSGANTQSQIDVKMSVDIFGRFYAERGILI"
     MKVPYFSQWE SFHLANDIIH HQLPLSHDPL WEQSGADSPE EYAKWANHIC GMACLKMLLA        60
     ARSGKIYPLL KLTKMATEYG AYQIEDEHIK GMIYAPVVSM LSEQFGIISQ IVTGMTAEKI       120
     HEVFTQDSLY IASVHPSIRW PTRLPEKKGG HLVLVTNATP EEITFHNPSG ANTQSQIDVK       180
     MSVDIFGRFY AERGILI                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page