(data stored in ACNUC1104 zone)

EMBL: FN667741.PE109

FN667741.PE109       Location/Qualifiers
FT   CDS             117474..117767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0023"
FT                   /locus_tag="XBJ1_0113"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79264"
FT                   /db_xref="GOA:D3UY86"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79264.1"
FT                   /translation="MATLSNERITTRVNSETKELLEMALSLSGYASLNSFIANAAVAEA
FT                   KRLIEQNMRIKLCQEDAVAFVHALEEPTQINERFLRAARRHKDLLDEDRVSK"
     MATLSNERIT TRVNSETKEL LEMALSLSGY ASLNSFIANA AVAEAKRLIE QNMRIKLCQE        60
     DAVAFVHALE EPTQINERFL RAARRHKDLL DEDRVSK                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page