(data stored in ACNUC1104 zone)

EMBL: FN667741.PE11

FN667741.PE11        Location/Qualifiers
FT   CDS             complement(11289..12530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0003"
FT                   /locus_tag="XBJ1_0011"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79166"
FT                   /db_xref="GOA:D3UXY8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79166.1"
FT                   /translation="MSLMKKYSVTNFVIYQVSDVLFTISIKTIGMLFTWVMLNQLGLVV
FT                   ELGYFLFISWALQVLTLLAFGLYGDKFSTKFYLISFCILSLLIISSLYFIESKNYFYWG
FT                   IFFIITSLFSILTQPIGNSIISRILHNTNTDLAFRARGLVSSLNVVSGPAISGILISYL
FT                   AYGHILVIVFCSVVISFLGFLWVSMMPSEKKADTSKVSLKILKNNPTELRLGAISGIFN
FT                   FVIVPLVSYFIPFLIIDTMKLGAFDLGIAEFFFGAGMFLGSSVLVKFFNQILGKGYASL
FT                   TGTILVSLGIFGVSISQSNIHINISMLIAGIGVVIYNINTTSIRMTATPSSQRHSMESV
FT                   FLSLCIIPIPLGMLFSTYSIQFLSVNSILLGMSLILLFCSILIIKTPNFMHLCKMSSES
FT                   LDGYYEKLYPRSVS"
     MSLMKKYSVT NFVIYQVSDV LFTISIKTIG MLFTWVMLNQ LGLVVELGYF LFISWALQVL        60
     TLLAFGLYGD KFSTKFYLIS FCILSLLIIS SLYFIESKNY FYWGIFFIIT SLFSILTQPI       120
     GNSIISRILH NTNTDLAFRA RGLVSSLNVV SGPAISGILI SYLAYGHILV IVFCSVVISF       180
     LGFLWVSMMP SEKKADTSKV SLKILKNNPT ELRLGAISGI FNFVIVPLVS YFIPFLIIDT       240
     MKLGAFDLGI AEFFFGAGMF LGSSVLVKFF NQILGKGYAS LTGTILVSLG IFGVSISQSN       300
     IHINISMLIA GIGVVIYNIN TTSIRMTATP SSQRHSMESV FLSLCIIPIP LGMLFSTYSI       360
     QFLSVNSILL GMSLILLFCS ILIIKTPNFM HLCKMSSESL DGYYEKLYPR SVS              413
//

If you have problems or comments...

PBIL Back to PBIL home page