(data stored in ACNUC1104 zone)

EMBL: FN667741.PE128

FN667741.PE128       Location/Qualifiers
FT   CDS             complement(135443..135805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0026"
FT                   /locus_tag="XBJ1_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79283"
FT                   /db_xref="InterPro:IPR021238"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79283.1"
FT                   /translation="MKFVIGGQIEKERIAESIRQLAGDKATAITIMNDIEAAMAIKNGD
FT                   ADYYLGACNTGGGGALAIAIALIGLNQCATISMPGKILSDDEIIAHVKAGKKAFGFTGQ
FT                   DIDVVLPVIINTIVSQ"
     MKFVIGGQIE KERIAESIRQ LAGDKATAIT IMNDIEAAMA IKNGDADYYL GACNTGGGGA        60
     LAIAIALIGL NQCATISMPG KILSDDEIIA HVKAGKKAFG FTGQDIDVVL PVIINTIVSQ       120
//

If you have problems or comments...

PBIL Back to PBIL home page