(data stored in ACNUC1104 zone)

EMBL: FN667741.PE129

FN667741.PE129       Location/Qualifiers
FT   CDS             complement(135891..136979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0026"
FT                   /locus_tag="XBJ1_0133"
FT                   /product="putative phosphotriesterase with
FT                   metallo-dependent hydrolase domain (modular protein)"
FT                   /EC_number="3.1.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79284"
FT                   /db_xref="GOA:D3UYA6"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79284.1"
FT                   /translation="MGYQKQTGNTPTHSATYSSSRIDEAEDALKQADYQEYQVKRRGET
FT                   LLYSSNKQLNNPHLGTQQNTCIDTSGYTYVHEHLHIDLSGAKGSLDCRLDQYDLIVDEL
FT                   RHLYTLGLRNIAEMTNRYMGRNANFLLDLMRDSHINIIASTGYYKEPFFPAHFSELSVQ
FT                   AIADDMIAEIETGIDGTGLKAGVIAEIGSSLDQITADEKKVFAAAALAHHATGCPISTH
FT                   TTLSTMGREQLALLKEFGVSAEHVAIGHCDLKDNLDTIIPLLEEGAWIQFDTIGKNNYY
FT                   PDSGRIAMLREVAKRGLLGQVMLSQDITRRSHLKSNGGIGFDYLLTVFVPMLLAAGFSQ
FT                   TQIDLMLRDNPAQFFRHGFSKT"
     MGYQKQTGNT PTHSATYSSS RIDEAEDALK QADYQEYQVK RRGETLLYSS NKQLNNPHLG        60
     TQQNTCIDTS GYTYVHEHLH IDLSGAKGSL DCRLDQYDLI VDELRHLYTL GLRNIAEMTN       120
     RYMGRNANFL LDLMRDSHIN IIASTGYYKE PFFPAHFSEL SVQAIADDMI AEIETGIDGT       180
     GLKAGVIAEI GSSLDQITAD EKKVFAAAAL AHHATGCPIS THTTLSTMGR EQLALLKEFG       240
     VSAEHVAIGH CDLKDNLDTI IPLLEEGAWI QFDTIGKNNY YPDSGRIAML REVAKRGLLG       300
     QVMLSQDITR RSHLKSNGGI GFDYLLTVFV PMLLAAGFSQ TQIDLMLRDN PAQFFRHGFS       360
     KT                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page