(data stored in ACNUC1104 zone)

EMBL: FN667741.PE130

FN667741.PE130       Location/Qualifiers
FT   CDS             complement(137076..138251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79285"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79285.1"
FT                   /translation="MFINALKKQNPKLIEIAKDLWQQGAILPDTYIIDVDQVLDNGRHL
FT                   LQAAEQYGIELYLMTKQIGRNPWLAQKLIELGYPGVVAVDFREAYALSQHGIPLCHIGH
FT                   LVQTPAHLIETMLKQHPGIITVFSIEKAQAISDAAEKLGRIQPIMLKVFDKRDITLPSQ
FT                   EAGIFFDELDTTVDVLKTMPGIKLSGLTHFPCLEWNARYQTTLPTINLQTLLRARNRLE
FT                   QLGIELSQINAPSASSCNTIPLLAKYGATHLEPGHALTGTIPANISGQEPEKISMVYIT
FT                   EVSHHYDGNSYCYGGGYYKRGHMKYALVFPEHARSPKTVRVLSLGDPCIDYHIPISGIH
FT                   PIGSPVIMCFRTQIFVTRSDVALVSGIQSGSPKLQGIYDSQGNWKNRGYFQ"
     MFINALKKQN PKLIEIAKDL WQQGAILPDT YIIDVDQVLD NGRHLLQAAE QYGIELYLMT        60
     KQIGRNPWLA QKLIELGYPG VVAVDFREAY ALSQHGIPLC HIGHLVQTPA HLIETMLKQH       120
     PGIITVFSIE KAQAISDAAE KLGRIQPIML KVFDKRDITL PSQEAGIFFD ELDTTVDVLK       180
     TMPGIKLSGL THFPCLEWNA RYQTTLPTIN LQTLLRARNR LEQLGIELSQ INAPSASSCN       240
     TIPLLAKYGA THLEPGHALT GTIPANISGQ EPEKISMVYI TEVSHHYDGN SYCYGGGYYK       300
     RGHMKYALVF PEHARSPKTV RVLSLGDPCI DYHIPISGIH PIGSPVIMCF RTQIFVTRSD       360
     VALVSGIQSG SPKLQGIYDS QGNWKNRGYF Q                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page